Cluster: cluster_4459

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-F: 3, CAS-I-E: 20
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 100.0
Mean length of the directons containing the candidates 2.1739130434782608
Percent of cluster members that occur in self-targeting genomes 10.0
Number of members in the cluster 23
Model score for cluster 0.28
Consensus sequence MILWAFASLFAATAVPFDGRAFAALFTVSRKPRFQGCRISALKGFSTSF
Accessions (where available) / Location CCQY01000326.1:7228-7449:+
KDV57026.1
LM996379.1:20134-20319:-
EKK46195.1
KDV61397.1
EKJ65418.1
EKK76713.1
EHW68014.1
KEN33209.1
KDU40023.1
KDZ74945.1
KEK73157.1
EIH46887.1
EKH04874.1
ERC66990.1
EII22818.1
EHW62759.1
EII20338.1
EHW62627.1
EKW02641.1
KDT25723.1
EZJ32194.1
KDZ84635.1