Cluster: cluster_4514

CRISPR-Cas subtypes that co-occur with the candidate CAS-III-D: 4, CAS-I-B: 16, CAS-I-C: 9, CAS-II-C: 7, CAS-III: 3, CAS-III-B: 7, CAS-III-B, CAS-I-B: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 47.83
Mean length of the directons containing the candidates 4.260869565217392
Percent of cluster members that occur in self-targeting genomes 38.1
Number of members in the cluster 23
Model score for cluster 0.7
Consensus sequence CGMGITLPPISEDDVLELENYISCAVSQMGQPESETLRQFFDFLREKCREIESERWRNDP
RNWGACCKWPYDDDLPF
Accessions (where available) / Location KIQ93617.1
ALJT01000013.1:339676-340014:+
ACJ33165.1
KN127219.1:378847-379155:-
CZIN01000036.1:7783-8019:+
CZJA01000279.1:9668-9904:+
CZJP01000317.1:32089-32325:-
CZIZ01000954.1:1059-1295:+
EPZ37795.1
ESU71171.1
KLR75318.1
JYCG01000063.1:2931-3164:+
BBJV01000041.1:24759-24992:-
JYCF01000092.1:20987-21217:+
KQC48543.1
EMI10388.1
KIQ93368.1
BCPV01000109.1:2153-2377:-
JFHZ01000090.1:17256-17471:+
KMY64659.1
KMY63352.1
KIP21118.1
ALJT01000014.1:136180-136404:-