Cluster: cluster_4739

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-A: 22
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 90.91
Mean length of the directons containing the candidates 1.9090909090909087
Percent of cluster members that occur in self-targeting genomes 81.82
Number of members in the cluster 22
Model score for cluster 0.72
Consensus sequence MLRFRNKRIQTVSNNEMIHYYSLEKHKINALHSLVDFAENLSAKGFKLDSSFQSAYDACL
VMYQRTGVPSFSYLERLYGEIIPIYYNNKWQGHIMAESPKKLELALHWVGQMNANADELQ
SALIDLKMIES
Accessions (where available) / Location CEET01000148.1:1158-1553:-
CEDM01000009.1:156551-156946:+
CEEM01000027.1:1152-1547:-
CEFB01000046.1:1166-1561:-
CEIB01000025.1:1165-1560:-
CEKR01000005.1:1162-1557:-
CEFD01000018.1:22605-23000:+
CEGU01000017.1:58544-58939:+
CEJW01000026.1:1162-1557:-
CEHY01000138.1:22607-23002:+
ALA27979.1
CEHS01000051.1:1166-1561:-
CEDW01000060.1:1158-1553:-
CEJL01000034.1:1150-1545:-
CEHH01000032.1:156541-156936:+
ALMF01000057.1:24086-24481:+
CEKG01000062.1:22190-22585:+
CEEE01000023.1:1162-1557:-
CEHR01000038.1:6877-7224:+
CEFE01000009.1:7943-8290:+
ALLJ01000041.1:11342-11689:+
AHF58807.2