Cluster: cluster_4939

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 10, CAS-I-B: 3, CAS-I-E: 11
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 100.0
Mean length of the directons containing the candidates 2.380952380952381
Percent of cluster members that occur in self-targeting genomes 19.05
Number of members in the cluster 21
Model score for cluster 0.39
Consensus sequence MTGRPALIPKTYGFPWCQEDPNYVPFPSRNKLERLESDLN
Accessions (where available) / Location EKQ82088.1
EKR06977.1
EMN24668.1
EMO81671.1
EMK13662.1
EMN03844.1
EPG49535.1
EMK01276.1
EKO50279.1
EMO77510.1
EMY16339.1
EKR64467.1
EMO07894.1
EKP15289.1
ENO62655.1
EMO63815.1
EMN58352.1
EPG59654.1
EKQ98621.1
EKQ93154.1
EMJ79321.1