Cluster: cluster_5186

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-F: 14, CAS-I-C: 1, CAS-I-E: 6
Percentage of cluster members that co-occur with known Acrs 25.0
Percentage of cluster members that are adjacent to an HTH protein 95.0
Mean length of the directons containing the candidates 4.85
Percent of cluster members that occur in self-targeting genomes 40.0
Number of members in the cluster 20
Model score for cluster 0.45
Consensus sequence MHRSDACLMQTVMIFGAGCGTVSDAACHFRALQPSHSDDFPNAPEPIGLDTDSYSFTDDD
LMAFR
Accessions (where available) / Location ATOJ01000032.1:69221-69424:-
ATOI01000102.1:69219-69422:-
ATOL01000039.1:69219-69422:-
ATOK01000021.1:1315-1518:+
KGZ25584.1
ATOM01000058.1:69221-69424:-
KE375696.1:18944-19147:+
ATOG01000098.1:18944-19147:+
FCOY01000006.1:819949-820131:+
LDET01000031.1:105401-105604:+
ABVX01000011.1:70288-70488:-
CYTI01000027:6129-6329:-
JTOI01000005.1:172454-172651:+
JTPE01000030.1:68191-68352:+
JTMV01000040.1:41636-41797:-
JTYY01000004.1:268464-268625:-
JTTV01000009.1:164880-165041:-
JTPV01000010.1:105006-105167:-
AFT71022.1
AKA21925.1