Cluster: cluster_5306

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 18, CAS-I-F: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 10.53
Mean length of the directons containing the candidates 3.8947368421052633
Percent of cluster members that occur in self-targeting genomes 11.11
Number of members in the cluster 19
Model score for cluster 0.19
Consensus sequence MLPSEMMTWQPEFTDKTLSRKPGAVHWRSILTFCGTLFTWMQQQNISDIRSANSWIPTFL
DCHHYEAEVTVCEGEIHV
Accessions (where available) / Location ELD30378.1
BCNP01000045.1:6003-6455:+
EGW73163.1
KXQ08001.1
KUT65712.1
KUW41598.1
KUS38902.1
KUU22712.1
KUU42817.1
KUT20436.1
KSY13204.1
KUT19008.1
KHH36867.1
KDV32555.1
AMJQ01000550.1:339-530:-
AORB01000017.1:1539-1730:-
EGI88701.1
EGI88829.1
LM996392.1:147448-147627:+