Cluster: cluster_5365

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-A: 1, CAS-II-C: 14, CAS-V-A: 3, CAS-I-C: 3, undetermined (CAS-II-C/CAS-II-B): 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 10.53
Mean length of the directons containing the candidates 4.157894736842104
Percent of cluster members that occur in self-targeting genomes 10.53
Number of members in the cluster 19
Model score for cluster 0.22
Consensus sequence MPNNYDDIINIKYPKSRKHPRMPLEKRAAQFAPFAALTGYEDAIEEKKREMERELEKSDY
HNEEISD
Accessions (where available) / Location AUKC01000004.1:86620-87111:-
JNJK01000009.1:2970-3455:-
ENZ61161.1
EID33113.1
KE384120.1:442937-443173:-
AUJV01000003.1:68558-68794:+
AUKD01000005.1:232061-232297:-
AUJK01000010.1:54738-54962:+
AJC91277.1
AKFN01000110.1:5859-6050:-
CYRB01000038.1:233-424:-
ALU99850.1
CYRN01000099.1:194-385:-
CZHG01000093.1:130-321:-
LISK01000012.1:5117-5308:+
CYQQ01000111.1:5056-5247:+
CYQY01000096.1:1322-1513:+
CYQP01000095.1:286-477:-
CYRH01000163.1:118-309:-