Cluster: cluster_5381

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-C: 18, CAS-I-B: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 68.42
Mean length of the directons containing the candidates 4.526315789473684
Percent of cluster members that occur in self-targeting genomes 5.26
Number of members in the cluster 19
Model score for cluster 0.27
Consensus sequence MEIINTLIKFFNSFGVFVLLGIAIIVLWILSIREKNRKEREVYEAIRREEVSRISDGVAS
GIVRIFNDKSFIQALNNGVSIEVKINVDGSQNIIINGNGNQIQRV
Accessions (where available) / Location EIB69467.1
KQK49986.1
CZHW01000039.1:150899-151216:+
EAQ94945.1
KRS65375.1
AJA55472.1
KRS46747.1
EIB60246.1
EIB85353.1
KQH40576.1
EIB76149.1
LIRY01000017.1:6010-6327:-
AJK85157.1
EIB72877.1
AJK71438.1
KRS87017.1
KQH37741.1
EFV06422.1
KB894738.1:35747-36052:-