Cluster: cluster_5629

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 14, CAS-I-B: 3, CAS-III-B: 3, CAS-I-F: 1, CAS-VI-B: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 61.11
Mean length of the directons containing the candidates 2.166666666666667
Percent of cluster members that occur in self-targeting genomes 16.67
Number of members in the cluster 18
Model score for cluster 0.59
Consensus sequence MMEKYVGQTVEIIYMDRKGKITQRRIEVRGIRGGLIRATCLTTGQPRVFRVDNILAWHPV
ASRHTA
Accessions (where available) / Location EES73829.1
EOS57676.1
AIQ59665.1
ETK26706.1
AHD05863.1
ASSF01001063.1:11470-11682:-
AKG36064.1
KHF34084.1
AHM65875.1
KJK28214.1
KKD52408.1
ALP34822.1
KJD39817.1
EHB50141.1
BAZT01000003.1:395668-395862:-
ANHX01000004.1:325966-326193:+
AUFO01000011.1:293683-293889:+
EHQ62314.1