Cluster: cluster_5688

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 18
Percentage of cluster members that co-occur with known Acrs 7.14
Percentage of cluster members that are adjacent to an HTH protein 88.89
Mean length of the directons containing the candidates 3.222222222222221
Percent of cluster members that occur in self-targeting genomes 14.29
Number of members in the cluster 18
Model score for cluster 0.59
Consensus sequence MNQVQMNEFGLAESLESALAQINALANVAQHTISSAGGSIYLNEAAQLLLTIKNLAADAE
RYRAEWEDLIPRIRR
Accessions (where available) / Location CDG91806.1
CDG88121.1
ESN30355.1
CEP75278.1
AMFN01000024.1:14030-14275:+
GAS01070.1
GAR36630.1
GAR05518.1
GAS01075.1
ESH02073.1
GAS52324.1
GAR36625.1
GAR12757.1
GAR05513.1
GAR34045.1
GAR90862.1
ESJ58754.1
GAS52319.1