Cluster: cluster_5778

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-F: 6, CAS-I-E: 12
Percentage of cluster members that co-occur with known Acrs 11.76
Percentage of cluster members that are adjacent to an HTH protein 16.67
Mean length of the directons containing the candidates 2.888888888888889
Percent of cluster members that occur in self-targeting genomes 64.71
Number of members in the cluster 18
Model score for cluster 0.29
Consensus sequence QSFAQWWNACRAAMLQGGQPVSNRDELSSPVIPDGYALVPIEPTEYMVINGFESEPDPHF
SDEKEWEEYEAMSGCRRAAHRAELCWAAMIKAAPKQEGNNG
Accessions (where available) / Location KLW48323.1
JVUJ01000527.1:3208-4017:-
KLW48329.1
KDF60772.1
KJM01268.1
KJM05086.1
KNV27834.1
KOJ99207.1
KNK79803.1
KNI67578.1
KUC82694.1
KNU79309.1
KNT36192.1
KNI09809.1
KNP53917.1
KNW12316.1
KNU90372.1
KUA63947.1