Cluster: cluster_5937

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 14, CAS-I-F: 3
Percentage of cluster members that co-occur with known Acrs 13.33
Percentage of cluster members that are adjacent to an HTH protein 70.59
Mean length of the directons containing the candidates 3.941176470588237
Percent of cluster members that occur in self-targeting genomes 6.67
Number of members in the cluster 17
Model score for cluster 0.39
Consensus sequence MPLLDKLREQYGVDRYCANCILPRQRITTVSNSDIIRINAVPVRSAMTG
Accessions (where available) / Location ENC72563.1
EIH90255.1
EHV13051.1
EII13229.1
ERC44329.1
EIQ16459.1
EIH88376.1
EIH57781.1
AMF86867.1
EIG83325.1
EFZ66585.1
EMV83246.1
EHN91909.1
AICG01000005.1:346380-346535:+
EFZ52218.1
ESP27788.1
ESP27234.1