Cluster: cluster_5941

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-C: 17
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 76.47
Mean length of the directons containing the candidates 4.705882352941177
Percent of cluster members that occur in self-targeting genomes 5.88
Number of members in the cluster 17
Model score for cluster 0.21
Consensus sequence MQLSLFDENNLKDLGIQSIKAYEEKNEKKLKDLIFKINCVLNLDSQKDLVLQIRSIYIEI
YKNFLKDEEIKNLTLGFVIKLSLIYDKSVLEELKKINISNNFLQDVLKMDLQNFSKEIKL
FVKENLKNQISEKHIEIKQLKIFDLYKKIATYIYIKKFKRYGLLSYIQKNTQDDKLKNQT
YDLMNAFRFYLNDFFENFDMSRGLKE
Accessions (where available) / Location EIB72875.1
KQH37743.1
CZHW01000039.1:152208-152828:+
AJA55474.1
AJK71440.1
EIB85355.1
AJK85159.1
KRS65377.1
EIB76147.1
EFV06420.1
KRS87019.1
KQH40574.1
EIB69465.1
EIB60244.1
EAQ95055.1
KQH24054.1
EFC32459.1