Cluster: cluster_6001

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-F: 17
Percentage of cluster members that co-occur with known Acrs 29.41
Percentage of cluster members that are adjacent to an HTH protein 100.0
Mean length of the directons containing the candidates 5.0
Percent of cluster members that occur in self-targeting genomes 64.71
Number of members in the cluster 17
Model score for cluster 0.32
Consensus sequence MEQINPSVMIKTPWLLHGAFFMIGHGDNIPKITTHIPFLNLNFWHQTLNIMQNKSAKPK
Accessions (where available) / Location EGE25830.1
EKF83733.1
EGE24447.1
JVRY01000010.1:18096-18275:+
EGE16500.1
JVAC01000023.1:80409-80588:-
ADG61393.1
JVKW01000045.1:68105-68284:-
EGE20205.1
JVRZ01000041.1:18433-18612:+
JVAA01000052.1:67770-67949:-
EGE10100.1
EGE20922.1
JVKY01000032.1:80059-80238:-
JVFD01000016.1:18141-18320:+
EGE10718.1
EGE26280.1