Cluster: cluster_6162

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 15, CAS-I-F: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 11.76
Mean length of the directons containing the candidates 3.0
Percent of cluster members that occur in self-targeting genomes 0.0
Number of members in the cluster 17
Model score for cluster 0.27
Consensus sequence MKFIEVDEIGYENALGRGKSLVNVNGIESIRSGEFTEIRMMSGGIIPCRDSVESIKSKMS
GQWLYSYSDLQKQ
Accessions (where available) / Location KNL80016.1
KNL73198.1
KNO28457.1
EFJ74676.1
ESE13818.1
ELE02418.1
KUD22492.1
YP_006560572.1
KUA77887.1
EZA79697.1
EQX55977.1
KNS11488.1
EQZ39894.1
AIBK01000053.1:35741-35962:-
EQZ44564.1
AKA90023.1
KNL63882.1