Cluster: cluster_6276

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-A: 16, CAS-I-C: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 12.5
Mean length of the directons containing the candidates 2.5625
Percent of cluster members that occur in self-targeting genomes 18.75
Number of members in the cluster 16
Model score for cluster 0.56
Consensus sequence MKIKLFNRKRIETGYNEYMDLPKFETNEEFENRVNSFIADKKVIDIKYQEATYGNYEDME
ETCELSVLYQ
Accessions (where available) / Location EFM26449.1
CDEY01000007.1:121088-121552:+
AIK74907.1
KUE91297.1
EPV44974.1
CDEF01000001.1:192110-192328:-
CDED01000010.1:84910-85128:+
EPV27554.1
EPT75760.1
AIF87630.1
EPW32191.1
EPV23816.1
CDDN01000021.1:192110-192328:-
KXA51524.1
EPV14160.1
EJS82813.1