Cluster: cluster_7091

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-C: 9, CAS-VI-B: 7
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 53.33
Mean length of the directons containing the candidates 3.466666666666667
Percent of cluster members that occur in self-targeting genomes 53.33
Number of members in the cluster 15
Model score for cluster 0.71
Consensus sequence MSYFLYHQTPEFLFCELPIKDGSPNDDRLWVYCVKALSLIEFICLNDIKDHGFRGADERD
YENERWGGAFVQNNCEYLGHDENEVIKNAWEFLTDYFDWEDKNIDESSTSTLN
Accessions (where available) / Location EFT36298.1
AFD55127.1
ADQ83064.1
KB206044.1:4938-5279:+
AKQ40677.1
YP_007003676.1
ADZ11425.1
AKP70220.1
YP_009321840.1
AKC21341.1
AKC18973.1
YP_009322897.1
AKC23713.1
CAL42898.1
YP_008320438.1