Cluster: cluster_7151

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 13, CAS-I-F: 14
Percentage of cluster members that co-occur with known Acrs 41.67
Percentage of cluster members that are adjacent to an HTH protein 100.0
Mean length of the directons containing the candidates 4.357142857142857
Percent of cluster members that occur in self-targeting genomes 41.67
Number of members in the cluster 14
Model score for cluster 0.52
Consensus sequence MKHLELAPPATLSASARAQEITTILAAAIVRTFVVEVRPSAESGLGFLPDQSVYTTPYPQ
EFS
Accessions (where available) / Location JZIA01000003.1:2989467-2989658:-
CBA16866.1
JZHZ01000007.1:491662-491853:+
JZIC01000001.1:371063-371254:+
JZIE01000001.1:2934112-2934303:-
JZIB01000003.1:3673097-3673288:-
JZHX01000001.1:2718353-2718544:-
JZIG01000004.1:2566996-2567187:-
JZIL01000006.1:2745739-2745930:-
JZIA01000003.1:2734638-2734829:-
JZII01000001.1:3540182-3540373:-
JZIG01000004.1:2575618-2575809:-
JZIF01000003.1:2747706-2747897:-
JZHY01000003.1:3549309-3549500:-