Cluster: cluster_7387

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 2, CAS-II-C: 4, CAS-III-A: 2, CAS-III-D: 1, CAS-VI-A: 1, CAS-I-B: 6
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 7.14
Mean length of the directons containing the candidates 4.928571428571429
Percent of cluster members that occur in self-targeting genomes 20.0
Number of members in the cluster 14
Model score for cluster 0.31
Consensus sequence MRKEKSRSPPKLSNGRLPLILACLPTTCKNTDSQGCVSIDFTLYYLWDCWYFPNCQNKKS
QSYN
Accessions (where available) / Location EHO27899.1
EEG88743.1
EEC89773.1
CRL41231.1
EEG88738.1
CEK00058.1
CAJ70294.1
CAJ67207.1
CEJ96903.1
EHO28293.1
CBL08324.1
CCL05603.1
CCL41019.1
EEV01096.1