Cluster: cluster_7585

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 3, CAS-II-B: 10, CAS-I-U: 2, CAS-I-C: 1, CAS-I-F: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 71.43
Mean length of the directons containing the candidates 4.785714285714286
Percent of cluster members that occur in self-targeting genomes 7.14
Number of members in the cluster 14
Model score for cluster 0.49
Consensus sequence HQTTMTDINRRYLTVSNWNNYHPWPPSGGLRHLIFNEKTNGFDQFNVIKRIGRRVLIDEA
AFFAWVDSQGGKA
Accessions (where available) / Location EHL24404.1
CAH13273.1
AVAP01000243.1:2382-2588:-
ERI48895.1
KK074174.1:164780-164986:+
ERH45187.1
BAYP01000020.1:95641-95847:-
ERH41953.1
GAN27488.1
ERB42285.1
AWQT01000306.1:2666-2872:-
JNLB01000023.1:34264-34485:-
AEF99447.1
AQOV01000002.1:134865-135107:-