Cluster: cluster_7958

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 4, CAS-II-A: 11, CAS-I-C: 2
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 7.69
Mean length of the directons containing the candidates 4.153846153846153
Percent of cluster members that occur in self-targeting genomes 7.69
Number of members in the cluster 13
Model score for cluster 0.45
Consensus sequence MVEIEIKVVQKSVYVDDPKIIVYPSFYGIEVIAEGDERIKVSPLYPFTTSLNEDCRLALE
EFISDFKEELKLYYQASGKYKTKSLTTMLFGFDTELKEKFKDKWFKRGVVLN
Accessions (where available) / Location ALYW01000070.1:5890-6237:+
EMB84092.1
JVEO01000009.1:19071-19409:-
EMC16351.1
EMC33392.1
EMB68645.1
EMC18240.1
EMC53092.1
EMP60259.1
EMC42321.1
AAN57988.1
EMB76046.1
KB904562.1:250223-250525:+