Cluster: cluster_80924

CRISPR-Cas subtypes that co-occur with the candidate None (candidate detected solely in phages)
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 100.0
Mean length of the directons containing the candidates 4.0
Percent of cluster members that occur in self-targeting genomes 0.0
Number of members in the cluster 1
Model score for cluster 0.97
Consensus sequence MFYLMKESVVEFIVKLRVAHWVRKYGCSFRNVVSYHKNGYVRPLVPQFHQGRVKFDEEAY
QKLCKILHRKVTVDTWEIDIPDSETKTKIHPVTTPCVAIPAWLVTGEVRDFGRKHHGQIY
IPLYKDVI
Accessions (where available) / Location YP_009278725.1