Cluster: cluster_8151

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-C: 9, CAS-I-C: 11, CAS-III-B: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 15.38
Mean length of the directons containing the candidates 3.615384615384616
Percent of cluster members that occur in self-targeting genomes 23.08
Number of members in the cluster 13
Model score for cluster 0.2
Consensus sequence MKQTNKSDRFRRYLNRALLVFWVLLLALVVRACNQPAHADTEQAEPETPAIWETDPTAGI
VLEPVTEEAEQ
Accessions (where available) / Location JUNU01000234.1:6501-6749:+
JVBE01000040.1:3268-3483:-
JVLA01000008.1:39914-40129:+
JUTD01000057.1:5902-6117:+
JVVZ01000379.1:7962-8177:-
JVKZ01000034.1:34421-34636:-
AEPF01000099.1:9804-10019:+
JVHF01000041.1:51942-52157:+
JUTK01000046.1:5667-5882:+
JVFL01000098.1:12258-12473:-
JVAU01000103.1:3527-3742:-
EIG29900.1
JURA01000019.1:5669-5884:+