Cluster: cluster_8267

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 4, CAS-I-E: 7, CAS-I-B: 2, CAS-I-U: 8
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 8.33
Mean length of the directons containing the candidates 2.416666666666667
Percent of cluster members that occur in self-targeting genomes 50.0
Number of members in the cluster 12
Model score for cluster 0.36
Consensus sequence VADSVHVYDPACLLVEAHVRVAFWDKAPSWIGTDPADLERPYVEFSVPAEDGLQLSLNPE
HARGLAAALLRAADAADAAIRDDAPQ
Accessions (where available) / Location AZWM01000001.1:102458-102880:+
KB896839.1:367354-367776:-
KB896334.1:55485-55856:-
KB898406.1:75278-75649:+
JNLS01000045.1:33577-33849:+
KB913036.1:1964678-1964938:+
KB896173.1:3348-3608:-
AZWU01000058.1:3681-3941:-
KB896478.1:3667-3927:-
KB896629.1:73838-74098:+
KB905359.1:5120846-5121106:-
AUKM01000028.1:69165-69359:+