Cluster: cluster_8424

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-B: 5, CAS-I-C: 7, CAS-I-B, CAS-III: 1, CAS-III-D: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 16.67
Mean length of the directons containing the candidates 3.0
Percent of cluster members that occur in self-targeting genomes 16.67
Number of members in the cluster 12
Model score for cluster 0.71
Consensus sequence MRYEDSMKGVADQIIKEQQRASKIKNNPEEFHWHDEYATLNFFRFICKNIGNLGNGEIEK
MVWRLKQIDQKAVENHVNGAVWAFDYDKMFCVLMENEICRKVCEKNKYNSWMHLIGQYCV
EMC
Accessions (where available) / Location EEG37686.1
ETD19466.1
BBZT01000007.1:44761-45132:+
LN913006.1:1168582-1168953:+
CRL39908.1
EHO84765.1
AKCD01000002.1:179840-180193:-
BBZQ01000066.1:11984-12337:-
CCK87137.1
EFH07420.1
CCK94236.1
ENZ58217.1