Cluster: cluster_8806

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 12
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 66.67
Mean length of the directons containing the candidates 2.166666666666667
Percent of cluster members that occur in self-targeting genomes 90.91
Number of members in the cluster 12
Model score for cluster 0.43
Consensus sequence MNKLTKISATALVALFLAACDKPAEKAPATEPTKTTEAAPTTTAPAAEAAKPAETAVAAP
SEAAKADYQKLVDWNTAQESTMATAQAELQKKLATQDPKQIQEGLSAFNKKVEETVKSLD
AIEVSDAQIKTFKEKTKSVLTLSSEVISEQVKTISTPNDQAALQAVQQKAQSLIEAGNEL
QKLNVELQQRFSAK
Accessions (where available) / Location AKA13363.1
AGQ40865.1
EPZ03499.1
AGR75778.1
AGI31935.1
EDN75169.1
AGK03233.1
EPZ29250.1
AKA10758.1
AGQ25307.1
AJE08747.1
AJE08748.1