Cluster: cluster_8900

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-B: 5, CAS-I-C: 5, CAS-V-B: 1, CAS-I-A: 1, CAS-III-B: 4, CAS-I-B, CAS-III-B: 1, CAS-III-C: 1, CAS-III-B, CAS-I-B: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 9.09
Mean length of the directons containing the candidates 4.545454545454546
Percent of cluster members that occur in self-targeting genomes 30.0
Number of members in the cluster 11
Model score for cluster 0.43
Consensus sequence MTQGHFRPNMDYKEAFCEAVTELINQNIPDRSERIKAIEALTDAYVDSTGERPDSAQLER
LADYLLYEELTDRHPDKVTRTEYPIMSDRQLDRRHNGEATMKAAEYVGTDGRNYRVPKRR
KRSRWETWYVDRNAKVRNKERKKQYRKDTRPGDVSTYYIDN
Accessions (where available) / Location KFN01598.1
EJR82867.1
KI301978.1:113147-113665:-
JATL01000060.1:37938-38453:-
ETK27981.1
CH981502.1:16621-17079:-
YP_009210604.1
ETK27460.1
AHD06460.1
BAF60326.1
ACV62733.1