Cluster: cluster_8902

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 8, CAS-I-D: 1, CAS-III-B, CAS-I-B: 1, CAS-II-C: 1, CAS-I-B: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 45.45
Mean length of the directons containing the candidates 3.545454545454545
Percent of cluster members that occur in self-targeting genomes 72.73
Number of members in the cluster 11
Model score for cluster 0.7
Consensus sequence AGAKKRLRMNTPAEVRRTLARVSNMVVNGEIDSKEANTIIYSCNAILNAIRVDEQEKRID
ELEQYINNLK
Accessions (where available) / Location EJF39201.1
ENZ69372.1
ENZ64626.1
KMW11626.1
ENZ29780.1
ENZ04176.1
KJJ71712.1
BAIF02000002.1:55706-55894:-
KEI17791.1
EDT71838.1
KEI10830.1