Cluster: cluster_9269

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 8, CAS-I-F: 3
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 72.73
Mean length of the directons containing the candidates 3.1818181818181817
Percent of cluster members that occur in self-targeting genomes 18.18
Number of members in the cluster 11
Model score for cluster 0.34
Consensus sequence MAIQITQLHQADIFGYIADMLETARLLSSLEKGEQLAFELIYFAQQAAREAANKPWDE
Accessions (where available) / Location EFZ58756.1
EDU66537.1
EGI93194.1
CCQN01000121.1:18798-18974:-
EGX08467.1
AOUP01000564.1:9565-9741:+
AOUQ01000178.1:15155-15331:+
ELE53813.1
AYMN01000028.1:70671-70844:-
AYMQ01000077.1:70671-70844:-
ACA67497.1