Cluster: cluster_932

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-A: 101, CAS-I-C: 9, CAS-II-C: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 55.45
Mean length of the directons containing the candidates 1.554455445544555
Percent of cluster members that occur in self-targeting genomes 27.72
Number of members in the cluster 101
Model score for cluster 0.29
Consensus sequence MKDFGKCFCCWRICPHRNNYFIDAFTRKVDIATYFSRGDDAILAVIGISLIAMGTSVYYH
KYKDR
Accessions (where available) / Location ATOS01000012.1:58660-58857:+
AUVQ01000008.1:59987-60184:+
CDDR01000009.1:59628-59825:+
JUUD01000007.1:12039-12236:-
ATOR01000018.1:59595-59792:+
ANQG01000011.1:60456-60653:+
CDEA01000003.1:11359-11556:-
ANCL01000057.1:36502-36699:+
KLJ44601.1
ANQH01000013.1:61687-61884:+
ANPZ01000039.1:32181-32378:-
AUVT01000004.1:59899-60096:+
CDCJ01000028.1:30529-30726:-
ANQL01000015.1:59050-59247:+
ANQE01000012.1:62664-62861:+
ANQM01000022.1:12295-12492:-
JUUN01000084.1:96089-96286:+
JUUT01000051.1:59393-59590:+
CDCS01000007.1:59628-59825:+
AUVX01000008.1:60033-60230:+
ANQB01000011.1:61789-61986:+
CDEC01000002.1:20999-21196:-
ATON01000058.1:2686-2883:+
AUVY01000006.1:30953-31150:-
CDEM01000012.1:20999-21196:-
AIF87889.1
ANQS01000029.1:27039-27236:-
ANQX01000010.1:62395-62592:+
JMBK01000007.1:58899-59096:+
AUWD01000011.1:59900-60097:+
AUVS01000017.1:30970-31167:-
ANQJ01000017.1:12296-12493:-
CDEG01000003.1:59628-59825:+
KE376215.1:29458-29655:+
AUVW01000010.1:62697-62894:+
AUVR01000006.1:59721-59918:+
EPV78939.1
AUWC01000011.1:32449-32646:-
AOSD01000014.1:43776-43973:-
CDCW01000022.1:11359-11556:-
CDED01000016.1:26544-26741:-
ANQN01000072.1:2879-3076:+
ATPC01000093.1:2684-2881:+
KE376160.1:26638-26835:-
KLK18632.1
AUWB01000005.1:59652-59849:+
EPW50207.1
AUWG01000005.1:61774-61971:+
AUWI01000018.1:32503-32700:-
KLK72144.1
KE376185.1:59342-59539:+
AUVU01000003.1:30796-30993:-
AUVV01000015.1:59960-60157:+
ANPS01000069.1:24884-25081:-
CDBM01000009.1:59429-59626:+
KLJ48087.1
AUWA01000018.1:96546-96743:+
ANDT01000004.1:59761-59958:+
JVJV01000013.1:26669-26866:-
CCYF01000001.1:55505-55702:+
CDEN01000027.1:59344-59541:+
ANQQ01000028.1:59868-60065:+
JVKH01000037.1:10856-11053:-
AUVZ01000020.1:59996-60193:+
ATOW01000031.1:30485-30682:-
ANQF01000089.1:25298-25495:-
ANQT01000051.1:11595-11792:-
CDDM01000002.1:11303-11500:-
ANQW01000018.1:20098-20295:-
KLK57279.1
ANQI01000015.1:62259-62456:+
ATOT01000076.1:2682-2879:+
ATOP01000014.1:2684-2881:+
ANQK01000016.1:58989-59186:+
JMBJ01000006.1:58626-58823:+
CDCF01000012.1:59423-59620:+
JUTW01000028.1:19935-20132:-
KLL80220.1
ANPQ01000037.1:3151-3348:+
ATOV01000008.1:59586-59783:+
ANPP01000011.1:61194-61391:+
JUKX01000028.1:19502-19699:-
CDCV01000019.1:58764-58961:+
AUWH01000005.1:30812-31009:-
ATOY01000024.1:59593-59790:+
CDEF01000007.1:26544-26741:-
KLJ27185.1
CDCH01000028.1:11303-11500:-
JVII01000017.1:59371-59568:+
CDBX01000009.1:11303-11500:-
ANQP01000003.1:60729-60926:+
KE376197.1:79789-79986:+
AUWF01000005.1:30615-30812:-
EPU58858.1
CDEP01000012.1:59600-59797:+
JPOV01000004.1:19752-19949:-
JMBI01000006.1:59096-59293:+
ANDC01000004.1:12234-12431:-
ANPW01000069.1:24884-25081:-
AUWE01000009.1:61647-61844:+
ATOO01000327.1:273-470:+