Cluster: cluster_9328

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 9, CAS-I-C: 1, CAS-I-B: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 100.0
Mean length of the directons containing the candidates 4.727272727272728
Percent of cluster members that occur in self-targeting genomes 36.36
Number of members in the cluster 11
Model score for cluster 0.49
Consensus sequence MSTAHHSRKSPLPWCDLRQRDDEHPTCDGREQVVLVGLDGQEQRLCPAHAAALWLTDPTL
RFSAKTRPEAIAAVMRQAFGGGG
Accessions (where available) / Location EFE67109.1
KUN72009.1
BBYG01000009.1:452802-453062:-
BARF01000070.1:34940-35197:+
AUKR01000013.1:184544-184696:-
ALAP01000015.1:139659-140015:+
KDS89904.1
KNE83501.1
KPI18686.1
BBOM01000013.1:1357-1554:+
KB898297.1:35999-36160:-