Cluster: cluster_935

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-A: 99, CAS-II-C: 3, CAS-I-C: 3
Percentage of cluster members that co-occur with known Acrs 0.99
Percentage of cluster members that are adjacent to an HTH protein 98.02
Mean length of the directons containing the candidates 3.99009900990099
Percent of cluster members that occur in self-targeting genomes 29.7
Number of members in the cluster 101
Model score for cluster 0.42
Consensus sequence MFGMDKNNLEDLTGKKILRNGFGGLRLEYGTIFLDVGLFTYIVLILSIFFFLVERWFLGA
LTFVLHVPLLLLGIWCGER
Accessions (where available) / Location CDCJ01000028.1:26270-26521:-
ATOV01000008.1:63791-64042:+
ANQP01000003.1:64934-65185:+
AKI94636.1
ANQH01000013.1:65892-66143:+
AUWI01000018.1:28244-28495:-
AUWE01000009.1:65852-66103:+
JUUN01000084.1:100294-100545:+
AUVT01000004.1:64104-64355:+
AUWH01000005.1:26553-26804:-
AUVU01000003.1:26537-26788:-
CDEG01000003.1:63833-64084:+
CDEP01000012.1:63805-64056:+
ANPP01000011.1:65400-65651:+
AUVR01000006.1:63926-64177:+
AUWF01000005.1:26356-26607:-
AUWB01000005.1:63857-64108:+
AUWD01000011.1:64105-64356:+
AUVQ01000008.1:64192-64443:+
JUTW01000028.1:15676-15927:-
AUWG01000005.1:65979-66230:+
AUVY01000006.1:26694-26945:-
AUVW01000010.1:66902-67153:+
KE376215.1:33791-34042:+
AUVZ01000020.1:64201-64452:+
AUVX01000008.1:64238-64489:+
ANQT01000051.1:7449-7700:-
AUVV01000015.1:64165-64416:+
ANQW01000018.1:15838-16089:-
CDDR01000009.1:63833-64084:+
ATOS01000012.1:62865-63116:+
CDCS01000007.1:63833-64084:+
AUWC01000011.1:28190-28441:-
ANQX01000010.1:66600-66851:+
AUWA01000018.1:100751-101002:+
ATOW01000031.1:26226-26477:-
EPU48377.1
EPU59151.1
KLL67123.1
EPV18512.1
EPV76861.1
KLJ73196.1
EPW92544.1
AAM99128.1
EPU64886.1
EPV74291.1
KLL42930.1
EPX38035.1
ALP86818.1
EPX08969.1
KLL15293.1
KLK57514.1
KLJ22141.1
KLL60894.1
BAH80800.1
EPW27126.1
KLJ67668.1
EPW51276.1
EPU28627.1
KLL54318.1
KLK09497.1
EPW99086.1
EPU33781.1
KLD92428.1
EPW18256.1
EPW95358.1
EPW36477.1
EAO73935.1
EPW28777.1
KLL55823.1
EPU57141.1
EPV61273.1
EPT74634.1
ETJ96252.1
KLJ63896.1
EPX43329.1
KLL16846.1
EPW12525.1
KLL71523.1
KLK19860.1
KLL63208.1
EPW61887.1
EPU68427.1
EPW89832.1
EPW47053.1
KLK26403.1
EPX03917.1
EGR87399.1
CCW37081.1
EPX18100.1
KLL48860.1
KLK42250.1
EPU93290.1
KKC16372.1
EPV70474.1
EPX18699.1
KXA51025.1
EPT98916.1
EPU53241.1
AIF85795.1
EPV45334.1