Cluster: cluster_9668

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 10, CAS-I-F: 2
Percentage of cluster members that co-occur with known Acrs 9.09
Percentage of cluster members that are adjacent to an HTH protein 81.82
Mean length of the directons containing the candidates 2.363636363636364
Percent of cluster members that occur in self-targeting genomes 9.09
Number of members in the cluster 11
Model score for cluster 0.28
Consensus sequence MKKIIAGVVLALGLVGAANAEQYVQGDSVKRAAVAPSLNQLCTELAQVAGVGDDDDFITA
CVWSHIEDINKRDAKLTGKKY
Accessions (where available) / Location AICC01000176.1:7521-7766:+
KNG07281.1
EMX53420.1
EYY87529.1
EYZ95117.1
KLG79865.1
EIG43786.1
LBBN01000043.1:20757-21002:+
EZA41839.1
EGB43363.1
JSOL01000060.1:41224-41463:-