Cluster: cluster_9772

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 10
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 90.0
Mean length of the directons containing the candidates 2.9
Percent of cluster members that occur in self-targeting genomes 30.0
Number of members in the cluster 10
Model score for cluster 0.24
Consensus sequence MYKIQFRNPQGRLVTAQNRDAETIQRYADQARQDMPEAHELRVREVVQDQASGDFIWADC
TADFTR
Accessions (where available) / Location JOAW01000022.1:18093-18299:-
KL569795.1:9641-9841:+
JOBG01000027.1:11041-11241:-
JODK01000029.1:76071-76271:+
JNWU01000011.1:111586-111786:-
JNZZ01000024.1:9562-9762:+
JNXB01000018.1:212852-213052:+
KL573617.1:10560-10760:+
JOFG01000010.1:131951-132151:-
EFL35509.1